PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa011726
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 240aa    MW: 26720.2 Da    PI: 8.9187
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58681310PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.3e-383291261
     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               +e+al+cprC+stntkfCyynnysl+qPryfCk+C+ryWtkGG+lr vPvGgg+rknk+s
  Lsa011726 32 HEQALNCPRCNSTNTKFCYYNNYSLTQPRYFCKSCKRYWTKGGSLRSVPVGGGSRKNKRS 91
               7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-282690IPR003851Zinc finger, Dof-type
PfamPF027012.3E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7893690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MDAAQWPKDG TSNGSYNNNN NQVEDKKVKP QHEQALNCPR CNSTNTKFCY YNNYSLTQPR  60
YFCKSCKRYW TKGGSLRSVP VGGGSRKNKR SMPQPIDLSH FSSQNFTTHE PTQQQQQQYH  120
LGFSQFLKLP KIENGNANFL SSSDADGLNS FSTRGTTSWD LMLNGTRFGL QDAKPTLGFP  180
FQGDGSFQVE GTESERIMLP FGVLNQHHSS RESGQSMGQG NSSGYWNGSF GGGDSSTLYN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023147.11e-58PREDICTED: dof zinc finger protein DOF3.7-like isoform X4
TrEMBLA0A124SAZ01e-114A0A124SAZ0_CYNCS; Zinc finger, Dof-type
STRINGPOPTR_0003s14450.11e-55(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.41e-37Dof family protein